DPCstruct | MC8985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Standard deviation of domain lengths | 11.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4MEH4 | 1-101 | MGGGLAAARGWAAEHGHLLAPLDATYQGAKVGIWLKNARTAARKAAEIERRRAEGLPVESSAGALSDERREQLEEIDASWCPSWPVT… |
| A0A0N0MYY6 | 1-81 | MATHFQRALACARAYADTHGTLVNATTDTVQDGLKLGQWLSNQRNKDHAPQLHHGAPSPRAQALSAVDPWWNPPWTLESQR |
| G2GNL3 | 369-438 | None |
| A0A1S6LPT5 | 1-79 | None |
| A0A6C1CC08 | 45-133 | None |
| A0A2A3HPP9 | 10-87 | None |
| A0A7Z0PTA3 | 286-371 | None |
| A0A7X0LUK2 | 69-174 | None |
| A0A495H3N3 | 503-582 | None |
| A0A1T3NI54 | 260-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.