DPCstruct | MC8983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 205 ± 29 aa |
| Standard deviation of domain lengths | 29.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0T8T7 | 34-182 | EVGAHFLEAVVKKFDEISKSDAEGKECENLIALIAHLYNFHVVHSLLIFDILKKLVSAFTEKDIELILFLLKNVGFSLRKDDALALK… |
| A0A6I9PFD2 | 9-217 | QHDPEYTVVEKRVGAHFLETVVRQFDEVYKNPSETKECDNLISIICHLYNFQVVHSVLVFDILKHLVGDFREKDIELVLLVLRNVGF… |
| A0A818G1K8 | 377-575 | None |
| E4YN31 | 422-606 | None |
| A0A1Y1YHQ6 | 377-612 | None |
| A0A0V0ZQE3 | 33-275 | None |
| A0A7R8X8R2 | 310-521 | None |
| A0A7J7A2B8 | 375-602 | None |
| A0A822CVP4 | 248-449 | None |
| A0A0F7SF90 | 632-876 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.