DPCstruct | MC8981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 130 ± 12 aa |
| Standard deviation of domain lengths | 11.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 44.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14973 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9PEQ8 | 2-129 | LPLSSLRLMASPLQLTYSYIWQVIRQRNVKQYAKVEEFVTMVTQTVPDLISFKQTAQLVLGLRARIILDLLQKDGPPDSKAIQTLIN… |
| A0A4W5KA10 | 10-144 | FLPPASLRLLVPPLRLVSAALWQVVQRRDVMDYGMVEEFVVTVLDIVPDLMSYRDKVQLIMGLRAQLVLKLLHSEHLADSETIQPHL… |
| A0A1S3QVE1 | 127-253 | None |
| A0A4W5KJ84 | 1-142 | None |
| A0A061A3G1 | 17-120 | None |
| A0A553N0D1 | 12-151 | None |
| A0A7J6D663 | 3-132 | None |
| A0A4W6FT34 | 4-132 | None |
| A0A1A8A8B8 | 153-288 | None |
| A0A5C6MH60 | 6-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.