DPCstruct | MC8980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820FXJ7 | 1-61 | MTLNDISTLESIDDLTAQQLQQILVHNYVSIAGCVEKSELISKVKLLYHDEKQKKESSAKI |
| A0A6I9PDP4 | 1-81 | MEVSPATQRRIRASLSDLDNEEAIENLSVRQLKEILARNFVNYSGCCEKWELLERVHRLYRENEHNRKSMENVSITPNTCA |
| A0A819TVS1 | 320-403 | None |
| A0A6F9CVA4 | 226-307 | None |
| A0A815TNI1 | 178-261 | None |
| A0A820G9I8 | 1-77 | None |
| A0A2U9CFF5 | 464-549 | None |
| A0A3M7PWX9 | 37-120 | None |
| A0A820L8S6 | 1-85 | None |
| A0A2C9KJM8 | 89-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.