DPCstruct | MC8979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 105 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 56.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7TWY1 | 16-114 | DSPVVHPCAEAPICEECRAADLCFFDPTCSSCQDVLSNPKTTISQLFAIMRQWIPQTQGHLTLLTREVLRRGAHVNDKDGLTDLSLL… |
| A0A6I9PCY5 | 1-118 | MTKEDVSKPVEGDALRDWASSHQRPIIHQVASAPMPSDCEFSFFDPSEPQCREVLLDPSTTIPELFAVLRQWVPQVQKNIDLIGNEI… |
| A0A4W5QGK5 | 10-93 | None |
| A0A2J8VND4 | 1-123 | None |
| A0A369SF59 | 8-107 | None |
| A0A812DIC1 | 1-122 | None |
| A0A7R8W5X2 | 1-127 | None |
| A0A0R3SJS0 | 2-90 | None |
| A0A2H1CXU0 | 19-116 | None |
| H3D0S3 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.