DPCstruct | MC8977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 6 aa |
| Standard deviation of domain lengths | 5.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167VQ66 | 472-592 | SSKRFTLTNQADPVDFLSWFLNSLHLALGGSKKPSPTPTSVVHAAFQGRVRIESQAITAHSDTQNARLVFTESGTINSQVTPFLILT… |
| A0A6I9PBY1 | 1-117 | MTWFLNALHGALGGTKKKTSSITKAFQGSMRIFSKKLPHPDCTPEEKEALLVTEEYQEQMSESTFLFLTLDLPTAPLYKDEKEQLII… |
| A0A0L0S0G1 | 271-393 | None |
| A0A6J5V5V0 | 1-123 | None |
| A0A653DH60 | 619-738 | None |
| A0A1I7VRR3 | 828-947 | None |
| A0A2Z6QLM8 | 796-915 | None |
| A0A2H3DYT4 | 190-293 | None |
| A0A2T9ZK64 | 22-140 | None |
| A0A183D8A4 | 65-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.