DPCstruct | MC8976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 292 ± 35 aa |
| Standard deviation of domain lengths | 35.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF14631- PF10152 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9CUH4 | 552-853 | ETYEEFYMMDPSEQRFCLDSWFHCINWFIELVNAFSTHTDTDNIRKVCFRLDQIVTLLELVAEKLPKSHDYKPPNCKFHYDCKPKPL… |
| A0A6I9PB99 | 1-310 | MDVVDKMESLSKAEREFLCTLLFHTINWFREVVNAFCRQKETEMKMKVMTRLQNITYLQTLLERALAGTPGYVPPVANFDGESPEGV… |
| I0Z3T3 | 326-630 | None |
| A0A4Z2B9Z8 | 126-443 | None |
| A0A8B6F0B4 | 9-288 | None |
| A0A446M8C0 | 472-815 | None |
| A0A177WJ38 | 215-464 | None |
| A0A1R1WXL7 | 1-241 | None |
| A0A1R1Y8M7 | 176-417 | None |
| A0A7J7NK00 | 280-621 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.