DPCstruct | MC8975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1PHM6 | 2-102 | ETRLKQLDQLHSFVEGVDKDLTLTLQNLQWDRKNLLSRLPMVTCRYNNNHKLPLEKAESHQTKCFMKLQGYSEDDELLPEPLDINAN… |
| A0A6I9P9T5 | 9-109 | AMEERQEQLRELTEFTENCKEKLNHILESLGWSLDYKQELMEQCPYDSHHRVPARSLEKHKASCSLRKMGYSAEEENTSKKTSPQKV… |
| A0A210PUV1 | 3-86 | None |
| A0A0C9RZ76 | 3-77 | None |
| J3QMA8 | 9-91 | None |
| A0A556TJU8 | 1-90 | None |
| A0A7J8FC82 | 9-91 | None |
| S7MSR7 | 9-101 | None |
| A0A452QGH6 | 9-90 | None |
| A0A3B3SW10 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.