DPCstruct | MC8973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 755 ± 61 aa |
| Standard deviation of domain lengths | 60.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.71 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0010- PF21010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835GCA2 | 2-734 | SVKNLFSSPFRERLNAYNSKLTWADGSTSDCIAFLNVYKVWSHLRQQQYFRSAGQSEVAWARRFYVQARALRELDELAKDLRKRLTT… |
| A0A6I9P7W7 | 1-810 | IGALSAKSDGTGQNDDGELTFLGRVLAHLPVDLCLGKMIVLGHIFGCLDECLIIAASHSQKSFFAIPSMQQLAGHRSKLAFAQGAQS… |
| A0A4W3IWW0 | 259-912 | None |
| A0A485NN40 | 1-663 | None |
| A0A6J0UZ75 | 452-1243 | None |
| Q296Q5 | 557-1368 | None |
| A0A5N3VJB9 | 472-1271 | None |
| A0A6J8D6G9 | 141-918 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.