DPCstruct | MC8971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 93 ± 5 aa |
| Standard deviation of domain lengths | 4.73 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.94 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0179- PF04675 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6Y1Y0 | 57-152 | FPPAIINAGEKIPAETLKSKMDEKALIVKTTYSELPNYDIVIKTMLEHGVDKLPDHCRLTPGIPLKPMLAHPTKGVSEVFNRFDKSE… |
| A0A6I9P6W0 | 1-100 | FPPAVIDAGKGMSAESRRAWIESKSLILKQTYCEMPNYDILIPVLLKEGIDELPNHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAA… |
| A0A7N0RCQ2 | 85-168 | None |
| A0A7C9EH37 | 89-176 | None |
| A0A817PMP4 | 167-260 | None |
| A0A6J3C6P8 | 436-528 | None |
| A0A565CG12 | 133-225 | None |
| A0A7N0VEP8 | 269-352 | None |
| A0A2T7PN09 | 122-221 | None |
| A0A822ZWF9 | 336-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.