DPCstruct | MC8970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 405 ± 57 aa |
| Standard deviation of domain lengths | 57.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14868 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9P6F5 | 24-493 | LKSVLPKLTSLHNNSESWDDHIRVLKIITDMFLPHIGLSELEDECFSKILPKAVTMFDRMMKEIMDHVGGLSSQNTELCSLLRNILQ… |
| A0A0S7H9X6 | 4-378 | LIDALSICVRHVGSFEEGLCFDAIRSLPTCILKVLRETFQHCKDSEMVYCGRLSLVADLLQRLFKEAYSLQKSLLEVLDRISLDSSA… |
| A0A0L8FZH8 | 15-393 | None |
| A0A6P3Y5S5 | 30-463 | None |
| A0A834XQ75 | 29-439 | None |
| A0A5K3F4Q0 | 1-414 | None |
| A0A5B7CTP4 | 4-361 | None |
| A0A1X7U1H6 | 77-470 | None |
| A0A166H1Y8 | 24-435 | None |
| K7GGN1 | 81-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.