DPCstruct | MC897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 62 ± 2 aa |
| Standard deviation of domain lengths | 1.76 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 71.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5GJD6 | 138-198 | GQLLRWFVALYEMEIVDEEAFLNWKEDVTDAYPGKGQALFQVNQWLTWLQEAESEEEEGDE |
| H9IV01 | 1-60 | MLLRWFMYLYNMEVCEEEAFLRWREDVTDAYPGKGEALFQVNTWLTWLQAQESEEEEADE |
| A0A6J2YH16 | 702-762 | None |
| G5AVR6 | 145-208 | None |
| A0A6P8T6R1 | 586-647 | None |
| A0A7M7NM51 | 895-959 | None |
| A0A6J2PVW6 | 499-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.