DPCstruct | MC8969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 140 ± 17 aa |
| Standard deviation of domain lengths | 16.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 58.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N4EB57 | 2-128 | VYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGR… |
| A0A6I9P637 | 2-127 | VFWLLSMLANRDKEEMSRTLLALSSSQDSCIAMRKSGCVPLLVQILHEAPSGGEAVTEGTVTGCSREARSRASAALHNIIYSQQDEG… |
| S4RZB8 | 2-160 | None |
| A0A803Y642 | 167-296 | None |
| H3CGK7 | 303-431 | None |
| A0A2G9RW06 | 43-175 | None |
| A0A4Z2BHS1 | 174-319 | None |
| A0A2G9SIC1 | 20-147 | None |
| A0A7R9AFV1 | 24-141 | None |
| A0A6J0Y3B4 | 74-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.