DPCstruct | MC8965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 411 ± 42 aa |
| Standard deviation of domain lengths | 42.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9P3U0 | 2-419 | FSHQGSESNYEELKEGANVTYLDMKLSQSGLVVLAAAWHLSDSPCLVYFCLVTLQDTGAAIADNFIVEVTKHNPPFQSEEALQETRL… |
| A0A061AZ32 | 1-394 | MLEIGTSANSVAVAGLTHLTYRSRLDPRPLSTPGLSLGSGEIAFVILANAVVIASVAHDSTFEEAFPLRKNTDRFLGLSMPSYHPSA… |
| A0A6V7X2A4 | 29-544 | None |
| A0A2I0T7X4 | 109-526 | None |
| A0A812I1A9 | 17-443 | None |
| A0A0D0V1D2 | 7-364 | None |
| A0A2H8TNC6 | 305-687 | None |
| A0A0J8S0X8 | 18-403 | None |
| M7X4V0 | 281-675 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.