DPCstruct | MC8962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 137 ± 9 aa |
| Standard deviation of domain lengths | 9.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12463 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y9QCI3 | 441-585 | LLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINSSLVDSNMLVRCVTLSLDRFENQ… |
| A0A6I9NX72 | 1-132 | MFLLKRGLLEHILFCIIDSGCTSRDVLQSYFDLLGELMKFNIDAFKRFNKYVNTPEKFQTFLTQINSSLVDSNMLVRCITLSLDRFE… |
| A0A2T7NH16 | 844-972 | None |
| A0A7J7JD65 | 179-308 | None |
| A0A4Z2GG41 | 135-288 | None |
| E9HCL4 | 551-679 | None |
| A0A444UR56 | 296-426 | None |
| A0A5F8G4K4 | 945-1089 | None |
| L7WF84 | 203-350 | None |
| H2ZFZ2 | 4-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.