DPCstruct | MC8960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 182 ± 42 aa |
| Standard deviation of domain lengths | 42.35 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2HWL3 | 180-348 | LRTKQMLLSPHLPIRISCLEILAKGLELLKNYDDALLPMIHQNWHGIMTIVKENEPMSMAEAFEVVVAMSKRSGTFVHGKVLNEFWP… |
| A0A6I9NV08 | 15-143 | KENELLPMAHRCWPPLLQRLTADEPLAVLRAFRVLCTLGETCGDFLRRRVSKEVLPKLSSSLLRQAPTSAKAGPVYTHTLNYKLQLA… |
| A0A2G5B6B9 | 55-259 | None |
| J9AII1 | 19-153 | None |
| A0A820UA71 | 507-666 | None |
| A0A5K4F907 | 82-310 | None |
| A0A5S6Q0I3 | 74-215 | None |
| A0A0B1RU55 | 2-129 | None |
| A0A816HJR1 | 6-160 | None |
| A0A183BBN2 | 5-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.