DPCstruct | MC896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 182 ± 33 aa |
| Standard deviation of domain lengths | 33.12 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7XPG1 | 132-276 | HLVFIDSLMVAHLRSIISIDRVVQAISNYTVIEKREEPLDCVDALLFWINKVCLIVRDDVERNCVALTNGRNESDEPSINGTTIPEM… |
| A0A5N4CIL0 | 18-238 | QSAHLAMIDTLMMAYTVEMISVEKVVACAQQYSAFFQATDLPYDIEDAVMYWVNKVNEHLKDIMEQEQKLKEHHTIEAPGGQKSPSK… |
| A0A0R3QW31 | 131-237 | None |
| A0A3Q0JD68 | 4-192 | None |
| A0A182TR31 | 7-167 | None |
| A0A498P3A3 | 1-133 | None |
| A0A0B2VSZ1 | 213-333 | None |
| A1ZAU8 | 111-314 | None |
| A0A6H5GGI9 | 1-173 | None |
| Q8C1B1 | 132-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.