DPCstruct | MC8958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 54.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1ZY08 | 1-77 | MFVVCLADSVLAFHRHGVQGRSLRSADVTQEIVDHSRAYRLLGADKVVVLESHTLQSKTLSSDDGNDLYILAIRASY |
| A0A2H1CJG2 | 187-257 | VVCLRDSILVFHPNGLLGKSFTGELTQEIHDDKHIYRLLGCDRNIIVESRPADDPMSNSNVYILAGHTDSY |
| A0A085LVJ4 | 630-694 | None |
| A0A654HV74 | 478-555 | None |
| A0A6P4EDG5 | 2-82 | None |
| A0A815TMZ7 | 105-184 | None |
| A0A673Z035 | 560-632 | None |
| A0A6P6XUY8 | 1135-1220 | None |
| A0A384DK18 | 1134-1207 | None |
| A0A402E8F3 | 268-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.