DPCstruct | MC8957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 177 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 28.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16717 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9NRI7 | 1-162 | MNRMRNLVDSAYSLDPRIKKFKDEEKARKEAEKKAKVEAKKREQEEKERARQAEIDAARLAKEKEEEEARQVAQLAKKEKEIQKKAI… |
| A0A1D6P6Y3 | 61-232 | MERQNAKLHEKAKKVEYARVHTLVDNVYKKDPRIQMRKEEHKAEKQRRKEAKYLTKKLQEEEATRAAEEERIRKEEESKKAAEAAQH… |
| A0A3P6TUS6 | 1-171 | None |
| A0A075B0B2 | 409-575 | None |
| A0A183JFG4 | 18-210 | None |
| A0A7R8VAJ0 | 524-699 | None |
| A0A3P7KMY4 | 1-179 | None |
| A0A061HPT9 | 1-187 | None |
| U1HVS4 | 393-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.