DPCstruct | MC8955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 206 ± 15 aa |
| Standard deviation of domain lengths | 14.74 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9NPQ2 | 1-229 | DGQPDILYTFWTDVTSTLSEEFHRATEASSFLKQAFEGEYPKLLRLYNELWRRLQQYSASLQGALNSGAGIEASLDISATESDTQDL… |
| A0A0D9WFX8 | 204-413 | TERVWDAIVKAFANQLKSAFTASSFVKEVFTLGYPRLFSMIENLLERILRDTDVKGTLPALTLEGKNHMTAAIEIFETAFLALCHSR… |
| A0A4S2L9V9 | 226-422 | None |
| A0A699ZE80 | 192-391 | None |
| A0A401NL54 | 185-415 | None |
| A0A7R9HU02 | 66-261 | None |
| A0A653D4S2 | 1-178 | None |
| A0A815GPV7 | 746-965 | None |
| A0A821C464 | 148-358 | None |
| S9WZD2 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.