DPCstruct | MC8952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 213 ± 37 aa |
| Standard deviation of domain lengths | 36.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8EYU5 | 1-153 | MNADLLSTLLSSANCDSYSIIVKYLNGIYDVLTPTIRRSLYNTLYAFLNGRFTSTGNACMINGETNKDWISNSFGRFSVYAPYNDLV… |
| A0A6I9NNU0 | 2-242 | LLTKLSPVLDPALDMLAGMPMPMVGPSASEVLDVLGEIRVSLLTDEELMNSSVIRKWFSQRLSAFLPFTSGRFLHCLTNRNLSCHSY… |
| A0A6P6PK40 | 1-274 | None |
| A0A1S3R899 | 22-216 | None |
| A0A7J5Y537 | 136-324 | None |
| A0A6P6PJ22 | 17-179 | None |
| A0A6P6PJW7 | 86-387 | None |
| A0A498NJI0 | 202-404 | None |
| A0A498N3A0 | 95-308 | None |
| A0A2G9RWK8 | 477-687 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.