DPCstruct | MC8950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.55 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9NKM9 | 1-90 | FPECGFFGMFDKILLFRHDLTSENILQRLSSAEEIHEGDLVEVVLSALATAEDFQIRPHALYVHSYKAPAFCDDCGEMLWGLVRQGL… |
| A0A226PUX7 | 1-82 | MYDKILLFRHDPTSENILQLVKSAGDIQEGDLVEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCE |
| A0A6P6DJU0 | 80-169 | None |
| A0A480NRE8 | 81-170 | None |
| A0A7R9QEC9 | 48-145 | None |
| A0A6A4VR06 | 200-291 | None |
| T1HA93 | 45-140 | None |
| A0A0V0TES7 | 53-139 | None |
| A0A6V7VH53 | 136-218 | None |
| A0A0D6M095 | 104-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.