DPCstruct | MC895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 155 ± 25 aa |
| Standard deviation of domain lengths | 24.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8I9J3 | 8-166 | SRLEAEIEKCRAECSWQRALEFVRQLVHKSPGFEYMVDFVMGECKLEEYLEKFPPCEKNINKAISELTEAEALLNRVIQGDNRFKFD… |
| A0A060WB10 | 8-151 | SRLETEIERCRSEGQWDKIPELVRQLSAKLISNDDLGELLLGEAKLQQYIKENPIKQGASPRGPRPRLVEVHKHLTAALDRGNLKPD… |
| A0A5N5SUT6 | 1-154 | None |
| A0A2I4D3U0 | 39-212 | None |
| A0A3Q4HT06 | 1-115 | None |
| A0A4Z2HNX5 | 1-105 | None |
| A0A183HBV4 | 1-154 | None |
| A0A183J8J9 | 1-192 | None |
| A0A401PMG4 | 3-174 | None |
| A0A5F9C6E1 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.