DPCstruct | MC8949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 207 ± 24 aa |
| Standard deviation of domain lengths | 23.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9NID3 | 28-215 | CGTGDPTVTVPRGLRCSNPERRKKLVLHVDLNNTILVSDSVIAQGTVAALEHFLSTVTWGRMSKGKWEWLSGSPSLHPPCDGAVSYH… |
| A0A2P4T887 | 9-193 | RLVLHVDLNNTVVAADAVSGLGPREALNIFLSTATWGREGADGEWQWMSDRPSLRAPCPGAVSYYCRYGRAQDFTESGPGQRFSSLH… |
| A0A1Q9D1W4 | 360-535 | None |
| A0A812IZU0 | 28-301 | None |
| B7G4B5 | 10-230 | None |
| S9TR77 | 12-201 | None |
| A0A0M0K9A9 | 166-355 | None |
| A0A812SQY4 | 125-341 | None |
| A0A1I8GXU9 | 40-243 | None |
| A0A024GJX9 | 4-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.