DPCstruct | MC8948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 8.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08463 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D0S162 | 88-176 | QPPLTRKERAENVRKRNYFTKYSEAAQAVLDNLLDKYADAGVQEIESIQVLKLKPFDSMGTLPEIIKTGFGDRNGYNQALSELENEI… |
| A0A0G0YGB8 | 1-90 | MGQEVDVFDLILHIAYGKKPLTRNERLKNVKQSSYFDKYEGKAREIINHLLERYAEHGITAIDNIGGLKFTPFDQYGTPVQIVDGIF… |
| A0A7V9F2N0 | 209-293 | None |
| A0A1J5H2N6 | 9-97 | None |
| A0A7C4N224 | 175-261 | None |
| A0A357HX71 | 347-433 | None |
| A0A0B7MMH0 | 11-93 | None |
| A0A1V4VS21 | 2-70 | None |
| C8PRL3 | 507-592 | None |
| A0A086P923 | 43-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.