DPCstruct | MC8947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 61.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0HFH8 | 7-69 | SAAPEPPFRPREKLVEKQRYFQSVHKPTYLKGRYDAIASVAIPLALAASSVFLVDLHKTVRSS |
| A0A6G1D272 | 108-177 | LCRMTEPPFVPRERLFKHQQYFRNVPKQTYLKGRYDVITSVAIPLVLAGTSLFLIGRGIYNMSHGIGKKE |
| A0A6G1EGP5 | 67-144 | None |
| A0A3L6TC36 | 148-219 | None |
| A0A0E0QC10 | 80-157 | None |
| A0A6P5ZT92 | 1-55 | None |
| A0A3L6RHQ1 | 12-92 | None |
| A0A0E0JVV5 | 2-67 | None |
| A2Y5D3 | 7-69 | None |
| A0A6D2L044 | 68-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.