DPCstruct | MC8946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 144 ± 19 aa |
| Standard deviation of domain lengths | 18.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0560 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445F9Q9 | 4-168 | AFPSVTSVTVENVTFPPTVKPPCSPNTFFLAGAGVRGLQIHHAFVKFTAICIYLQYDALSFLSVKWKTKSTHQLTESDQFFSDIVTG… |
| A0A6G1D0P2 | 36-186 | LAAAAASLTLTAKSAGRPPLHHPAPSAPLWASLSLADGATPGSVEPRTGAVFPAETAGGRRLLGVGLRRTTILGLKSIDVYAFGVYA… |
| A0A4Y9YWF3 | 61-230 | None |
| B9FY07 | 604-747 | None |
| M8AMP9 | 263-451 | None |
| A0A4Y1R1J3 | 3-144 | None |
| A0A5B8MCI5 | 40-184 | None |
| A0A7J6L365 | 503-659 | None |
| A0A4S4E031 | 696-800 | None |
| A0A6A6L6I9 | 186-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.