DPCstruct | MC8945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5BCU3 | 1-89 | MGFHFSLFLFLASLSVIWAQNVEDVTIVVNGTEVVTNTDDNYICATVDWWPHDKCNYDQCPWGSTSVINLDLTHPNLAKAIQAFKQL… |
| A0A6G1CXY6 | 1-105 | MELRRVLGGLLFLALLRLGAAAVAGGAAVDGRSAIAATDEDFVCATLDWWPPDKCDYGTCSWGLASLLNLVADHPLVLAFLPPIRAI… |
| A0A287HNH4 | 6-93 | None |
| A0A4D6M653 | 2-89 | None |
| A0A0A9CJU9 | 1-104 | None |
| M1D6H3 | 1-73 | None |
| A0A843UQA8 | 38-107 | None |
| A0A7J9F6J1 | 8-100 | None |
| A0A2P6PQF8 | 5-110 | None |
| A0A287V2E8 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.