DPCstruct | MC8944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 389 ± 82 aa |
| Standard deviation of domain lengths | 81.64 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 68.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.81 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0266- PF10513 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367IKC4 | 9-309 | FRVKKLSPKHPLPIYKESQLPDLVDPTNQIQRSVPQIETGVEKEEEEEHDLQAAISAHQAAVTTGAKVESYIPIPDASNTIDLKEYE… |
| A0A6G1CS86 | 1-419 | MSRLSFRPRPLDIHKKLPILKSAREFEDDDPTAAAVAVARAGVLLRQSGPELTAATTATEGEGNPTPTKKNVQEIPTPQFDAVDTYE… |
| S4RQB8 | 1-394 | None |
| A0A2C9JUC0 | 1-411 | None |
| A0A3Q0J9V0 | 134-506 | None |
| A0A0V0QH14 | 26-435 | None |
| A0A4U0VAR5 | 146-521 | None |
| A0A2H6KCA6 | 4-424 | None |
| A0A2H3C5N3 | 1-464 | None |
| A0A482VMK1 | 3-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.