DPCstruct | MC8941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 141 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3IV08 | 1-154 | MAALPSSLGAQVVTFAEVLLEDAAAWAACLPADVSTRSLEEVQAVLFAAWETAADLLPAATTQDPTHMQWAGAPTVELRLSAEGPHD… |
| A0A5P8K3I0 | 445-577 | DAAAWAAVLPSGSSTKLTLEEVEAVLLAAWETAADLLPAVVRDETTIRWAGAPTVELRLSAEGPHDQPRAGLGTLIDVRALGRTDRS… |
| A0A1C4X335 | 444-580 | None |
| A0A495W397 | 824-944 | None |
| A0A1S2KQN1 | 567-698 | None |
| A0A7H8HKI3 | 680-814 | None |
| F4CJ11 | 62-221 | None |
| A0A7W7I7C1 | 619-744 | None |
| A0A229RAV6 | 228-387 | None |
| A0A2I0STD7 | 684-836 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.