DPCstruct | MC894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9Q233 | 1-103 | MLGQEFLRKLKMPDLDDVSQYIQSVSTPVLVSVGAVAAATTYYLATRPKALPPVCDLRMQSVEVQGGELARRSVLLKGDANITHFYD… |
| A0A060W9A0 | 2-101 | DFLLNFLFSPLPTSAIVSLFALMGAALVYLNTRPKPLTMPADLNCQTVGVKDGARKSALQEDDNLMSYFHDDARTLYEVFQRGLQVS… |
| G1SPB6 | 1-104 | None |
| A0A812C8P0 | 12-134 | None |
| A0A4Z2B0K5 | 18-140 | None |
| A0A3B4XR25 | 1-130 | None |
| A0A1X7SZR7 | 15-92 | None |
| A0A0N4VWC0 | 7-118 | None |
| A0A5J4NZ49 | 28-136 | None |
| A0A368FQK2 | 7-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.