DPCstruct | MC8938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 122 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1HEA8 | 12-131 | ETIRYGDFRAAVVDALRVLADPEYQERVWIRHEFPPGIKYDELDYRVHILFDDMVVLPDPEPAIGALIYPDEVDTLRALGAVFESLI… |
| A0A7L6AY59 | 1-118 | MKYPEMRKELIAYLSGLSNLQYQRDCWVNGNCPDGVEHDEFDYVVHFLFDDTKLSSNPKSLIGYLLKNESETILIQRLCQEIERIFE… |
| A0A543EWC2 | 22-155 | None |
| A0A3N4RX18 | 1-113 | None |
| A0A4Q3ECQ2 | 18-155 | None |
| A0A0F3RBC8 | 8-132 | None |
| A0A7W7FWH2 | 142-255 | None |
| A0A852ZZI1 | 78-198 | None |
| A0A7Y9ID85 | 2-118 | None |
| A0A440U8C6 | 2-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.