DPCstruct | MC8936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 190 ± 19 aa |
| Standard deviation of domain lengths | 18.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5S102 | 8-166 | TIETVSVGNRGNTAYPNPWGDIGAVDYDYNIGKYEVTAGQYTDFLNAVAATDTYALYNTSMWTSGFGCKIQRVGDEGSYTYSVAPDW… |
| A0A1G3ZFZ2 | 2-175 | KILLILLVGISANANLLFAQSNSQPTASIRPIGRITTDTGQSLQEVEGVDVNTTLSTITARQYCNFLNAVASVNDCHHLYDSKNHSD… |
| A0A5C5ZN87 | 1-198 | None |
| A0A7V8AZV6 | 1-172 | None |
| A0A351FRB3 | 552-746 | None |
| A0A3L7PH20 | 19-205 | None |
| A0A3L7PCE3 | 50-256 | None |
| A0A5K7XB75 | 401-602 | None |
| A0A523EM38 | 1-212 | None |
| A0A4S5JUT9 | 32-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.