DPCstruct | MC8935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 215 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R3IR79 | 515-724 | GHNLQVNRLKVYGGRSGEVSNQIFPLHKDWRVLREFGQNLEDTRVNYRNAYNLIVAGRAEADPLEGVYKRLWNDPGTYSLNGERMAF… |
| A0A7L6AMT6 | 1-225 | MKWYNLQRARLKIYAGRSTEVSNNMFPLHTQWAWTVAHGLGKHPSQTRPANREAFTILQNAIRAGKPANSSHPLWAGTGIYDNAFER… |
| N8VHA5 | 1-228 | None |
| A0A2N1I7I3 | 758-950 | None |
| A0A838ZZM3 | 300-498 | None |
| A0A2E2VR27 | 989-1184 | None |
| A0A8A5E3V8 | 432-645 | None |
| A0A4Y7ZY52 | 727-964 | None |
| A0A261GI46 | 783-996 | None |
| A0A7U1H8U2 | 142-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.