DPCstruct | MC8933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 81 ± 3 aa |
| Standard deviation of domain lengths | 3.06 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A386EAF5 | 143-222 | VTGDVLAMLATCASGSLRDVRDRAILMVAFASGGRRRSEIASLRREQLTVEPPIVVADGLPSPLSPFILGGPKHPEPITT |
| A0A0E4BYH5 | 135-222 | DVLDRLLATCASDRLADTRDLAILLLAFASGGRRRSEVARLRVEQLSKEPEVLLDPCDPKSLTLPCLAIQLGRTKTGDASDEGRVFLV |
| A0A1S7SFN3 | 106-182 | None |
| A0A6N7LDN1 | 1-80 | None |
| A0A8A7B250 | 17-95 | None |
| A0A7W4R526 | 187-269 | None |
| A0A366FH57 | 218-298 | None |
| J2AQH9 | 100-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.