DPCstruct | MC8932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 106 ± 16 aa |
| Standard deviation of domain lengths | 16.07 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E4BYH5 | 1-87 | MGENSLRALSSDLAYLEAWAQAATGTALPWPASESLALKFVAHHLWDPARREADPQHGMPPDVVAALRESEMLRSDGPHAPSTVKRR |
| X6FIY5 | 1-124 | MSRRCATWRRKVIGDNSLRALASDLAYLEAWCQAAVDSSLPWPAPEPLLIKFVAHHLWDFSKRETDPSHGMPEDVSQSLRAQDLLRK… |
| A0A2P9HDT0 | 1-113 | None |
| A0A7W5TPQ2 | 1-87 | None |
| A0A520GCE2 | 28-143 | None |
| A0A4R1SUA1 | 1-87 | None |
| A0P1Q1 | 2-101 | None |
| A0A7W9YBY3 | 33-140 | None |
| D0RE77 | 46-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.