DPCstruct | MC8930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 144 ± 19 aa |
| Standard deviation of domain lengths | 19.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12982 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8B2Z1 | 194-357 | VYSALLAAKAVAKADVAVVAMGPGIVGTGSKYGYTGLEQGQVVNAIHTLGGRAVAVPRISFADQRERHRGLSHHTATALGDVALASC… |
| A0A538DQC2 | 3-135 | AVVCAIGPGIVGTGSMFGHGGVAAAEAANAAAALAGTPIVAVRASTGDARERHRGVSHHTRAVLELCLGDVVVPWPLGTEPPDWLEA… |
| A0A7V9K3X3 | 2-107 | None |
| A0A538L963 | 290-429 | None |
| A0A7V9CZC4 | 34-158 | None |
| A0A7W1TXX0 | 135-292 | None |
| A0A7V9Q1H8 | 18-144 | None |
| A0A7X8ERT4 | 26-180 | None |
| A0A7W0L4Y2 | 2-153 | None |
| A0A645FWK3 | 5-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.