DPCstruct | MC893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 209 ± 22 aa |
| Standard deviation of domain lengths | 22.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P4PJC0 | 304-507 | EFSEVENQDDYYSMGAASVYTQDPHGVHIMYDEALSDLKELEAELLLVASHYIEKEKGHREGSESNTGQDWGRAHASVDRFAVLYDM… |
| A0A060W303 | 1-217 | MEYPEVENLHDFYTTEERYVHTQDQRGLYVVYDVALKDLEELEDTLILLGSHYIQRTTDLHSAWAQTDVDRVAVLLDLWTCEAAFLE… |
| A0A0H5RUI4 | 509-676 | None |
| A0A817F0V5 | 437-668 | None |
| A0A3M7SID5 | 28-264 | None |
| A0A820HQT5 | 11-201 | None |
| A0A6J8CPH4 | 594-810 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.