DPCstruct | MC8929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 727 |
|---|---|
| Mean domain length (aa) | 274 ± 72 aa |
| Standard deviation of domain lengths | 71.56 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 11.56 |
| Pfam Score | 93.45 |
| Assigned Pfam label(s) | PF16466- PF20954- PF20953- PF05105- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A105TQQ4 | 9-252 | NAITKTTNFAIIDYLIDPRKNNLMSYGYFFNSSIFAGKATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHASSETDPRNLLFINFA… |
| A0A2S6NI59 | 52-300 | ASVEGRDLSASLVDSYRQLDFVNQTASQVVATIANWHSLEAIVTPTSGNTGRYFGEGYTRLSTGLYSRLCSDWDLVVQLARESNFDA… |
| A0A843PDU2 | 25-278 | None |
| A0A250FYV6 | 53-358 | None |
| A0A843GBX2 | 88-415 | None |
| A0A3S0YGL1 | 3-175 | None |
| A0A842MQ94 | 441-787 | None |
| A0A4V1QX63 | 9-493 | None |
| A0A376F976 | 7-217 | None |
| A0A7V9V7F8 | 11-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.