DPCstruct | MC8928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 172 ± 19 aa |
| Standard deviation of domain lengths | 18.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1FVH7 | 152-300 | EFGNNGNGDGYSHNMYIGNMKNFTLRYSYTHHSKIGHEIKSRSNNNYILYNRISDESSGTSSRNIDLPNGGLAVIIGNLIEQGPNSG… |
| A0A2S6NDH0 | 1-213 | MRAGFDHNIYVGAVTKFTLTNSYVHDVLDQGNEVKSRAQTTIITGNRIQDNSSVTSYAIDLSNGGSALVQNNVIQKGANSVQDAVVD… |
| A0A1Q3RCI8 | 133-330 | None |
| A0A167GQQ8 | 386-543 | None |
| A0A545TG68 | 181-327 | None |
| G2E6P2 | 194-359 | None |
| A0A522W1E3 | 75-260 | None |
| A0A0D6P8Z7 | 846-1013 | None |
| A0A2A4WJG8 | 195-362 | None |
| A0A1M3QBF2 | 153-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.