DPCstruct | MC8927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 189 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y0FV72 | 7-206 | AAALSAIGPALARRGLDLLSGVFRGALDKGTQEIAGFIEEKTGIDINDVADEKLTEEQWAKLREFEFQYQAKLLEYRQQLDANALEL… |
| A0A2S6N980 | 22-239 | PVGAAVGGLGGLVLDIAPDVGKWLFGSNGEHAATQVAKAVETVTGTSDAEAAQAVLARDPEAVTQLRVQLVTLAAQMQAEANRAAEA… |
| A0A136I157 | 1-156 | None |
| A0A1F9IXA8 | 4-172 | None |
| A0A0L0MEV2 | 1-179 | None |
| A0A0Q6EGA4 | 7-217 | None |
| A0A7W8UUC3 | 1-208 | None |
| A0A1H0M2S2 | 4-185 | None |
| A0A2E2HHS3 | 2-152 | None |
| A4JD47 | 6-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.