DPCstruct | MC8924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 225 ± 31 aa |
| Standard deviation of domain lengths | 30.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.85 |
| Pfam Score | 99.14 |
| Assigned Pfam label(s) | PF01814- CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836BVT2 | 27-244 | HQDGWKLSHDAIRRDMDALLSGLERTRALVESGRALEAWQVAHMQLLVKDMYHNVHAHHDHEEEIFFPWMESRVVVPPKMSSDHKTL… |
| A0A2E1NG81 | 20-244 | LFVPFSTSIASGKGKHLSKGLDLIHKVLSRPLDVGLSHIDKCLSLNKIDIQNHDGFKDYINSLVTVFFGHHHGEDEILFPTFEDKIK… |
| A0A445IZW2 | 143-426 | None |
| A0A7S4E648 | 1-243 | None |
| F4Q753 | 21-251 | None |
| A0A1Q3D8V5 | 92-304 | None |
| A0A4S2MI78 | 5-247 | None |
| A0A5N6Q7Q9 | 332-581 | None |
| A0A0W0VBA2 | 2-175 | None |
| A0A0G4LQA4 | 925-1178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.