DPCstruct | MC8923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 38.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5UNP4 | 1-100 | MDIDLKTKDGQNKFIEESLSGLLEGINNSYGPILMDELNSRIKRTIEEFNAEMVAAFDELKNKENNRQKMYSMIKEGSIPPKESQIE… |
| A0A2E1NCM8 | 1-107 | MSIDFSSQDDRISYLNEKLDDIVEGINAVYGSFLTDELVTRMERTIMDFNEEIESVMSDIKLNADKKNKMLHDIIDGNVVVKPKESE… |
| A0A2E5I7V2 | 1-103 | None |
| A0A2E5W4J4 | 1-112 | None |
| A0A2E2Z5Q6 | 1-109 | None |
| A0A3D2FSV9 | 1-108 | None |
| A0A2E5SIW4 | 1-104 | None |
| A0A2M7XVQ5 | 1-95 | None |
| A0A2E1WX28 | 1-96 | None |
| A0A383C3I6 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.