DPCstruct | MC8921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 191 ± 21 aa |
| Standard deviation of domain lengths | 21.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 22.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A119CWQ0 | 13-195 | SAGAAHAQMYRWVDGNGRVHYSDTPPVTYQKSGGAELSKQGNVIRRTQSEAERRAEAERQAEQKRIQAEQNKQAQLDRALTQTYTSE… |
| A0A0A8XHM5 | 2-171 | VWYRYYDQQGTANISTSVTPAHIRYGYEVLDQNMQVIKRNHSYNAQADLNQSSQRALSARHRELDIKLKKAYSNSKTATIKRDQALL… |
| A0A7C7UHW0 | 1-168 | None |
| A0A6M4HDZ2 | 11-211 | None |
| A0A661E6T3 | 21-212 | None |
| A0A4R6ZYS6 | 16-211 | None |
| A0A2E5C8E0 | 50-249 | None |
| A0A222FGH7 | 4-192 | None |
| A0A0M1J719 | 17-213 | None |
| A0A812S2N8 | 212-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.