DPCstruct | MC8920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 207 ± 14 aa |
| Standard deviation of domain lengths | 14.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5N2B9 | 18-221 | LKGIPVPEPSNINQFIANKAAAIRLGKALFWDTQVGSDGKTSCASCHFHAGTDNRTINQISPGLLRVASPGNADPDLSFKLGGPNYQ… |
| A0A7T0JNH9 | 18-220 | NAGAAVSLKAVAIPPVPGLNHYVRDQAMAILLGKALFWDMQSGSDGQACASCHFHAGADNRIKNSLNPGQAGGDNSFNETASGDAGG… |
| A0A3M2I0F7 | 21-207 | None |
| A0A5C6A783 | 213-421 | None |
| A0A1F9BU96 | 30-243 | None |
| A0A1Z8SBS7 | 3-222 | None |
| A0A3D3W504 | 131-326 | None |
| A0A536CVZ3 | 1-200 | None |
| A0A0J1H5J1 | 2-242 | None |
| A0A1H9D902 | 24-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.