DPCstruct | MC892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 212 ± 29 aa |
| Standard deviation of domain lengths | 28.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 38.13 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | PF15024- PF15027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W4HB08 | 148-361 | ASKVDWMRARWTSDPCYAFYGVDGSDCSFLIYLSEVEWFCPPLPWRNHSSQSTVSSAPERQAMVRSDLGPLLEQLGSGKESLSFMRR… |
| A0A060W2I2 | 19-237 | ISFFSNTNTLALHSQFLQARWDSDLCYAFYGVDGTTCSILTYLSEREDFCPPHPGRNHSAPPWHQQPHTHKEKAEVRTTLRPLYEVF… |
| A0A2R5FZV0 | 65-353 | None |
| A0A315VFB5 | 591-800 | None |
| A0A1S3R9K7 | 22-198 | None |
| A0A7D9DQN7 | 58-309 | None |
| A0A401S6K6 | 59-264 | None |
| R7T9E6 | 146-386 | None |
| S4RE96 | 5-169 | None |
| A0A3P6QVN6 | 674-894 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.