DPCstruct | MC8919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 4.77 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535WXJ8 | 1-93 | MEKFVDKNAEFVYVAADQVMTEARKQGATPYDVKDVELGHRGPECSFDAFVRKYGLAADPAMAYMAKVIRGADTTDKAITPESAYCQ… |
| A0A7J3T1T6 | 22-102 | RFVDPKAEFLFVPVEKIEETVQKEKAIPYDAPGVELGHHGDKCSFDAVVEKYKIKDPAVLELAKIVRAADTDNMEMAPEAA |
| A0A849EGX2 | 89-169 | None |
| A0A7C1TRF2 | 4-83 | None |
| A0A0E1W8P9 | 85-165 | None |
| A0A848ZFR1 | 74-154 | None |
| J3BUC3 | 1-84 | None |
| A0A4R2XKD0 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.