DPCstruct | MC8917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 8.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535W7S2 | 1-140 | MLTVTGADVRACNLAVWFLLRQMHRRRAAFWAWSTTEWIEILCPSSALFGHQHHVNGPYCRPYALAVAYLLCNFTPGMALGTVHYHW… |
| D3DCK9 | 87-217 | RAMLDATAVVLLRCAETGRSYWAWNDEEWAGLLGQDQQGFRKAAPGWADDAVRPYLAAHAFLLGGFTAFYRLGSFSRLTLAWRVFGR… |
| A0A535VP30 | 75-189 | None |
| A0A3E0CUP5 | 127-246 | None |
| A0A7X5XA72 | 2-129 | None |
| A0A7W7H2V6 | 87-210 | None |
| Q0RW12 | 212-339 | None |
| J2JQF6 | 77-206 | None |
| A0A150A0H9 | 29-174 | None |
| A0A499U9Z3 | 89-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.