DPCstruct | MC8914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 156 ± 19 aa |
| Standard deviation of domain lengths | 18.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2G5A0 | 9-148 | GCGILVHNEVTARSIELFEPTDTVEHEVRHLLLTYPDYSQPGSFFPDWGYQCLGHDSQAENTHWAPFIKASLEYIRDTYPRPWTDDH… |
| A0A061IAK6 | 13-183 | MPTGRLWSGLLLLLSFFCSRSSSCGLSTHVEIGHRALEFLQLQDGHINYKELLLEHQDAYQAGTVFPDAFYPSICKRGKYHDVSERT… |
| A0A2G5B7H7 | 1-166 | None |
| A0A814LEJ5 | 2-160 | None |
| A0A1R0H7D7 | 1-169 | None |
| A0A2E5X6C2 | 1-144 | None |
| A0A060T7C0 | 1-193 | None |
| A0A1R1PJ94 | 14-157 | None |
| A0A6J0CVT2 | 2-131 | None |
| A0A7I8WAR9 | 17-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.