DPCstruct | MC8913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 141 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 74.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7H3P5 | 1-148 | MAEYLSFAKIGNVFAYYVNSLFEEDANLPIIGLYAVMAVSLLVQIVLLARGLRNRDRNNLTTCLQEITALRNEVLENRLGQTTIVQQ… |
| A0A061I4K7 | 1-144 | MVEYLSFAKIGNIFAYYENSMFEEDANLPITGLYAIMAVSLLVQIILLASGLRNRDRDNLTTCLQEITALRNEVLESRLGQTTIVQQ… |
| A0A3L7IE27 | 1-143 | None |
| A0A3L7IMR6 | 1-141 | None |
| A0A3L7IJ53 | 1-112 | None |
| A0A3L7IF16 | 1-148 | None |
| A0A3L7I7W9 | 1-143 | None |
| A0A3L7HGK6 | 1-144 | None |
| A0A3L7GVU1 | 1-143 | None |
| A0A3L7HYW8 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.